DPCstruct | MC6456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 342 ± 36 aa |
| Standard deviation of domain lengths | 35.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1DZ27 | 7-346 | AEFLVEWLKVKGYKSSGDYHKIWDDIREIFDGIMYQAWLGPPQINQLCSGEVEDGEKKNFTKQDKELCKAMVRVLLYINGQKIGTYN… |
| A0A0D9QCQ5 | 1-319 | MAEKLGDLLADYARRRHMWGPDGTYEKGIWEDIEGIFSELEEALVKRDAVMDGLCKIMAEEEETKVQKMMVERICKHIIRIIFFAER… |
| A0A0D9QI12 | 3-368 | None |
| A0A0D9QHX8 | 6-425 | None |
| A0A0D9QIR1 | 5-392 | None |
| A0A0D9QDP2 | 1-375 | None |
| A0A0D9QRM0 | 9-312 | None |
| A0A1B1DTA0 | 27-373 | None |
| A0A0D9QGE0 | 2-294 | None |
| A0A0D9QQI7 | 8-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.