DPCstruct | MC64559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3N4J4 | 652-778 | CLEVNKDFKEGGLAGQEQAKALSDVIKRPVHIYEESGNIIVIGEQYLGTPIKVSYFPADEHNPTGHYVPYGKNENWSSSNGKNNCLF… |
| A0A183B512 | 192-334 | VNPKKWRRLERKQREGFKDPEAIQKAQQIIDDLRNNGKAGIIHLTHITDIIGKPITVLDENGKLLQNIRGKTDAEPIVVQYDSKNEH… |
| A0A814KWZ5 | 341-481 | None |
| A0A815SCG6 | 142-260 | None |
| A0A817MIF9 | 51-178 | None |
| A0A819SVG4 | 268-383 | None |
| A0A6V7JS27 | 179-333 | None |
| A0A4S2KE76 | 335-461 | None |
| A0A4S2KI92 | 784-927 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.