DPCstruct | MC64557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 246 ± 41 aa |
| Standard deviation of domain lengths | 41.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814PHW6 | 9-263 | VLEAARNIQFNLKLLDDKKNEFDAKPINQNDSVIPHVELIREPLQYPRTVCTNSTCVKYVKTREFDVIDYSTVCHDPYYLRNVKHDT… |
| A0A819IG47 | 422-648 | INSMIRPMLEAMRNMFRTLALWNMESTNVSMQGNPIALARPSAICLSCKRKHRRFGNLWIKIDDTHEFRDECQICRCSPSKHLPIDY… |
| A0A284R4B3 | 879-1125 | None |
| A0A7R9A7T6 | 538-789 | None |
| A0A7R9A8C4 | 282-539 | None |
| A0A821GJ64 | 27-287 | None |
| A0A175W469 | 785-1082 | None |
| J3NGB7 | 700-936 | None |
| J4HWI2 | 136-372 | None |
| A0A814JTA3 | 240-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.