DPCstruct | MC64556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 234 |
|---|---|
| Mean domain length (aa) | 204 ± 41 aa |
| Standard deviation of domain lengths | 40.65 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 97.12 |
| Assigned Pfam label(s) | PF02990- CL0020- PF00298- CL0072- PF00687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814NTS8 | 135-336 | ISEHEIALTAQQVKTKKRKFVETVELQIALKNFDPSRDKRFSGTVRLRHTPKPKFAVCVLGDERHCDEARANNIPCMTIDDLKKFNK… |
| W7FFY6 | 1-172 | MNIELRHSYYSSVLILVNDNSEKWKKLAIENKLRKIRKIMTYDKFEAVYNKDDLINEITSKFDLYIFDASIRSKKYSHVISKIKKHN… |
| C1BSZ3 | 98-261 | None |
| A0A5F4W9D7 | 8-197 | None |
| A0A6I9HFY9 | 1-124 | None |
| A0A4P1RIS4 | 87-279 | None |
| A0A256ZZM8 | 10-193 | None |
| R7WAN0 | 30-233 | None |
| R7WBV7 | 38-181 | None |
| A0A1V9ZDB1 | 13-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.