DPCstruct | MC64553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 174 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4IJP8 | 41-214 | KFDSMWPELANTFENFLFTKSVPPDNLSIQEFQRNENIDVEVVQLISTEILPYANFIPKEFVGQIMTMLNKGSIHSQSSSFTEAEID… |
| A0A812D7N7 | 233-404 | FQGMWPELALALEEFLFSKHPSPPTLSIEDFQRDETVDCKVVQVIRDDILPYAGTMPKDFIMKIMDILNKGSIHSATSDTFIDTESS… |
| A0A4Z2HQV3 | 749-918 | None |
| A0A060XBU3 | 188-360 | None |
| V4AFH7 | 441-619 | None |
| E9IJ77 | 22-189 | None |
| W8B1P0 | 34-242 | None |
| A0A3B3D441 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.