DPCstruct | MC6455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 622 ± 155 aa |
| Standard deviation of domain lengths | 154.94 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HTR3 | 1-396 | GSSGAPTRGGAHVLPTGRNFYSVDPKAIPSGLAWDVGCALADRLLERHLDETGTYPRTVGVVVWGTANMRTQGDDVAEVLALLGVRP… |
| A0A3S0GEY3 | 81-691 | FRAAGFGHVTVALAPERGDPAERRAQYHDPALPPRHGLLAFGLWLQENADALVHMGAHGTLEWLPGKHVALTRACFPEIVLGALPVA… |
| O26417 | 40-717 | None |
| A0A2N9IQT3 | 1-595 | None |
| A0A1U7PZB8 | 129-899 | None |
| A0A7S1TGH0 | 143-898 | None |
| A0A7W7A4Z3 | 214-905 | None |
| A0A1E3H0K6 | 123-768 | None |
| A0A849R219 | 173-995 | None |
| A0A843DZZ9 | 248-1026 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.