DPCstruct | MC64549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822FLP9 | 41-170 | RRQSIKHLSGMIKCAPQDTERITDAVILDYIPGLPAYILLMSIRYIDFVDDEAHVAGFLSARNEDIDYPILSITNTVRYLHRLQQYS… |
| A0A060XG67 | 1-149 | MLEYYKEDEALLVKTLITDMKPNAVSATVPCLPAYILFMCIRHADYINDDQKVHSLLTSTINAIKKVLKKNNNDFEMTSFWLANTSR… |
| A0A7E4RL08 | 1-173 | None |
| Q02440 | 1388-1599 | None |
| A0A3B4A8N8 | 81-280 | None |
| A0A183DTM0 | 24-222 | None |
| A0A7R9HU97 | 41-228 | None |
| A0A401PFR2 | 850-1049 | None |
| A0A6P7H7L6 | 53-175 | None |
| A0A4W5M909 | 31-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.