DPCstruct | MC64546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 25.35 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 54.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822F1I1 | 2-141 | GNEAGVDRLMKQISSFLSEISDQFKTVVIDAIKSLCQKFPRKHTVLMTFLSNMLREEGGYEYKKAIVNIIISIVEENPEAKEADCEH… |
| A0A452YGF9 | 24-161 | GNESSVDRLMKQMTNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFDYKKAIVDSIIILIRDIPDAKESGLFH… |
| A0A6P5MU53 | 1-103 | None |
| A0A2U1MQ62 | 62-207 | None |
| A0A820YMC5 | 58-220 | None |
| A0A820XNJ5 | 23-179 | None |
| A2FJW4 | 329-488 | None |
| A0A822HMW7 | 1-83 | None |
| A0A445DER1 | 125-298 | None |
| L8WDJ5 | 23-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.