DPCstruct | MC64544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 135 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815QEC5 | 67-195 | AQGDVVILSPFSHFMATSLNQRENMLEYGVMGSMSSVPANYNHSMIVFYSPHGVNEAMREWGQSMRRAFNRTMEHRLNDITINYLGY… |
| A0A822EUC1 | 1-151 | MYYNNSKHRYPYNNQVNLSQHGESDILVLSPFSRFMATSLSQTNSNTLEYGVMGSMLSIPANYNHSMIVFYSSQGINEGIKEWGQLM… |
| A0A820Y707 | 1-137 | None |
| R7VGN5 | 1-145 | None |
| A0A821Y217 | 1-115 | None |
| A0A2C9LGW2 | 2-131 | None |
| A0A2C9KQT9 | 20-151 | None |
| A0A820WTB7 | 1-148 | None |
| A0A0M0JDZ7 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.