DPCstruct | MC64542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0398- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822EDL4 | 1-92 | EVIKSAVELVLDSLKENARTLIAIGTYLIGKERIFHAIAKALDCKIFVETRKFRILNQLENTDLSTRLTTNADETNVHVVGMGSISQ… |
| A0A1B0CG65 | 103-194 | TILPSQDESIDMAIEETEKFLTKNIGQKCLIIVGTYIVGKERVWHTLATRFGFRVWLEGKRRQAVECMENPRLLEVLSADPCNAQIH… |
| U6MCL9 | 218-309 | None |
| A0A1D6ER02 | 403-494 | None |
| A0A453KUK7 | 328-416 | None |
| L1IUS1 | 165-257 | None |
| A0A0D0VRQ6 | 175-287 | None |
| A0A7S3SQN6 | 41-124 | None |
| A0A4P9Y700 | 264-347 | None |
| A0A7R9KME0 | 201-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.