DPCstruct | MC6454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662F3U7 | 18-125 | ICRKCGARCCRYVSYEMDEPENKRDFDDFRWFVMHKNVNIYYDTDGDWVLEFLTPCENLTADLKCKIHENRPMMCRGHDVNECEEHG… |
| A0A2H0W7B5 | 14-123 | LCDNCDLCCRYIAVGIDKPTNKTDYDNIIWQLLHENVNVFVDHDNDWYVEFMTPCSKLDQKTKLCTIYDDRPKICRDYKQTDCVRYN… |
| A0A1V4ZB18 | 6-92 | None |
| A0A017T4F6 | 28-130 | None |
| A0A402DMC9 | 200-326 | None |
| A0A1F7X488 | 1-142 | None |
| A0A7C8CTN2 | 2-85 | None |
| A0A0S8GQG4 | 6-110 | None |
| A0A7X7EQ45 | 10-122 | None |
| A0A2E9Q5L2 | 78-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.