DPCstruct | MC64538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015L1V4 | 23-109 | VFKFDSVTDTQWTEFADKADALCDVSSSTFSSWHINQMCEYLQSRILKAANVTLPSSIVGNNYTPKVPKDLEILTQHYQFLNRLMHS |
| A0A2N0NGH5 | 53-139 | IFKFDSVTTQQWESFSTHTDSLCDIPPSTFLTWHINQQYEYLHSRIVKAANASLLSVTVGNQHTPTMPKDLEALTQHYRFLSRLLHS |
| A0A2Z6QWD8 | 682-774 | None |
| A0A015KCV2 | 53-131 | None |
| A0A2N0S4F8 | 2-109 | None |
| A0A2H5SDQ1 | 242-338 | None |
| A0A2H5S7J6 | 46-149 | None |
| A0A2N0Q0W0 | 103-208 | None |
| A0A2H5R285 | 209-314 | None |
| A0A2Z6QYD4 | 40-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.