DPCstruct | MC64537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397T1E9 | 49-154 | NNILWNIIMDIVEFNSLKVNFVKIQAHSGIQYNETVDKLAKEFNNLNTLPLNFNIDQITTIKYVPKWNNIIIENNLRKFITSISRNR… |
| A0A015L0R6 | 1-104 | MLKEFNHLLWSSIRAIKSHKNLDVTLIKVPAHADDTLNNHVDALAKAAHTDSHLSSRPSLELFAPCILQFNSLPVDMNIRKFIRDIF… |
| A0A015L152 | 1-108 | None |
| A0A015L1C2 | 1-111 | None |
| A0A2Z6QLB7 | 2-112 | None |
| A0A2N1MC68 | 82-199 | None |
| A0A2N1M3A5 | 24-132 | None |
| A0A2H5UAR6 | 1-111 | None |
| A0A397GDJ5 | 1-119 | None |
| A0A2I1FKF3 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.