DPCstruct | MC64533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 133 ± 28 aa |
| Standard deviation of domain lengths | 27.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RS81 | 13-98 | INWKLSIRPPFPPLINPKDLIKQTKDGVYIRAPNAFIIYRKLFIETSRNEGYYLPMTVISSMSSQSWEQESEIVKNEYKRIAKAAF |
| A0A015KGW6 | 1-126 | MNVKKSTKYKIPLFKVPFPPELTVEEILNSRSEDKLKSRAPNRYLIYRLAFLKELRKRTDDNVSMTKISSHISSMWFNETTAIRDAY… |
| A0A397SEZ6 | 2-90 | None |
| A0A397SQK4 | 1-102 | None |
| A0A372QJE0 | 18-180 | None |
| A0A372QME3 | 15-110 | None |
| A0A397J0N1 | 1-111 | None |
| A0A397J605 | 6-154 | None |
| U9T0U0 | 48-151 | None |
| U9UJ41 | 4-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.