DPCstruct | MC64526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 499 |
|---|---|
| Mean domain length (aa) | 173 ± 33 aa |
| Standard deviation of domain lengths | 32.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 97.31 |
| Assigned Pfam label(s) | PF00566- CL0110- CL0033- PF07589- PF07534 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816N888 | 27-199 | FPKGTLLCHEHQIKLNEFYGKRNQKWRLAYKATRDGFASTDFYRCCDNKSPTLTVIQSSSGHLFGGFSLANWKSHDNWQWFTDRDAF… |
| A0A015JZH7 | 22-200 | SKIVNLSIILFISGYISKVEISKFSHFRELYLLYIPYKFKLLLRGSRDGFTPRKFHESCDNVSNTLTFIKVKGTEEIVGGYNPLRWE… |
| A0A6G1IQB7 | 201-396 | None |
| A0A7R9PPL1 | 366-549 | None |
| A0A0C2JB13 | 214-391 | None |
| F4PSZ6 | 1065-1235 | None |
| F4Q8D9 | 608-776 | None |
| M2S564 | 3-157 | None |
| M2S2G9 | 2-127 | None |
| A0A6P8HLH3 | 128-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.