DPCstruct | MC6452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 518 ± 79 aa |
| Standard deviation of domain lengths | 79.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.27 |
| Pfam Score | 52.38 |
| Assigned Pfam label(s) | PF05947- PF04865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5G2W1 | 1-488 | GSTTADLLLSVAGQAAADTVRDLIRNGTIQFLLIQEHLNPSTGREAGRDPAKRQLLKLLAGDQGAESRQDPLTGAWFVRVRWEEKDQ… |
| X5R209 | 13-549 | FDDLTAEALKRIRLACPDWTDFNPADPGITLVELFAWFTELMLFRMNKVPDKLHGELLSLVGIMPEPAKAARAMIEFTPLDNCPSSI… |
| A0A4R2JKT1 | 90-668 | None |
| A0A4V1XRP7 | 151-752 | None |
| A0A399I9Y7 | 351-896 | None |
| A0A416B7X8 | 1-443 | None |
| A0A2P5MSX3 | 34-602 | None |
| A0A7X6C9H9 | 606-967 | None |
| A0A7Y4X8W7 | 592-1078 | None |
| A0A2T5R345 | 214-672 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.