DPCstruct | MC64516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0193- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7IPQ0 | 19-122 | ITALIIVNVVFSILATAAFHVSARSTSWSDVLTWQLLGNLAGLITVLAFTGLLRYVPLSIAFPVTTGMSILGVQVLAARWLFHESID… |
| A0A1G3QKG0 | 4-111 | QYIYLMLAVVFNTSANLVIKGFAAKQSETILDLITNVPLFLAAALFGINFIYYTKALNFIDISIAYPIVVGFSIILIISFSILLFNE… |
| A0A268HI69 | 1-113 | None |
| I1D820 | 1-106 | None |
| A0A378F5A7 | 102-220 | None |
| A0A2D0JL83 | 69-198 | None |
| I0JLG4 | 2-96 | None |
| A0A1J1H5T2 | 3-142 | None |
| A0A0A2UY59 | 1-107 | None |
| A0A7C9DRW7 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.