DPCstruct | MC6451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8GFP7 | 11-133 | LFREVAKTQTAAPVWKEITVNTGGSDSTLQDIKVSNTSGGYAYQDSTQPNSAASNRFIYWRTTGDILELVEQSLDYNLIGSHVRYRF… |
| A0A3Q1IRK4 | 3-143 | MAAVLERSFIEICGFERETLHRFREVTVNLGLTALPGGAKFPDSAGAFHYEESGKLLSVTSNRFIHWSTSGDMVQLVEQSLDTNLLN… |
| F7AF74 | 4-129 | None |
| A0A6F9DNF1 | 4-133 | None |
| W2SYA6 | 4-123 | None |
| A0A2P5Y3V4 | 1-129 | None |
| A0A2A2KSX6 | 15-124 | None |
| A0A2K6S1J1 | 32-190 | None |
| A0A820Q4Z2 | 23-138 | None |
| A0A0N4T7Q6 | 34-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.