DPCstruct | MC64504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674I2M5 | 1-103 | MRGRLTYDQINGVVQDLNKAVVSKYKILHQPMKSMSSAVRNLYHRFLEEETKDTKGEFFIVEADIKEFTQLKVDKRFHSILNILRHC… |
| A0A287U0A7 | 29-138 | IGGSIMYMRGRLTLEKVNISINEVATYADVNAHLVACPKKKLSEDTWEKALELRDLAATEAVKGKHFFLEADIKGPGLKLDHTGKAI… |
| D8LPM8 | 13-125 | None |
| A0A0E0AJQ9 | 221-337 | None |
| A0A3B6AXJ5 | 115-223 | None |
| A0A026WWG8 | 54-184 | None |
| A0A068VFY3 | 1-107 | None |
| A0A4W2IKE0 | 92-207 | None |
| A0A0A0K8D0 | 1-107 | None |
| A0A5J4YXE9 | 241-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.