DPCstruct | MC64502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 213 ± 42 aa |
| Standard deviation of domain lengths | 41.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 59.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TXV6 | 1-219 | QPIFAQWVQNIHATAPGVTAPGATTSTSLTWGGGELVVVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLIFLKGVLFARSSRLIPD… |
| Q1MX23 | 336-605 | PIFVAYGIATHNTIADIHAAAKTGIFAHMTYINIGTPLHDAVFGSKGSISEFVAAHAIAGGLHFTMVPMWRMVFFSKVSPWTTKVGM… |
| G7IAB8 | 1-197 | None |
| A0A2G3B988 | 14-230 | None |
| A0A2G2XC02 | 126-383 | None |
| A0A7J9KA92 | 2-189 | None |
| A0A4S8I2Y4 | 823-1016 | None |
| A0A396I1Z4 | 191-367 | None |
| A0A2U1PTW1 | 130-291 | None |
| A0A2N9HCP3 | 116-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.