DPCstruct | MC64500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TU56 | 17-91 | SSTAGTQLVYWDSKVSVQDMDGMWSQPDVSKEWTNSGERRGNVRFSHDAKKRPYLSRVEVKAVAEIIISRHFSSR |
| A0A835QBC8 | 1-75 | MSISYKYWDDCVDPEDMQLMWHDVDVCKEWSDAGERLGQRVHLSRDPDGQTYVTQTEMRVVSRIIVDKHFKSQLD |
| A0A0D9VCQ2 | 1-73 | None |
| A0A287TTI3 | 34-111 | None |
| A0A2P5FLY2 | 2-76 | None |
| A0A7J9G4U8 | 33-111 | None |
| A0A7J6W7Z1 | 1-75 | None |
| A0A2R6PKK1 | 104-218 | None |
| A0A1D6QSC0 | 103-177 | None |
| A0A2P5XLV8 | 8-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.