DPCstruct | MC6450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212U7M3 | 22-86 | HLDRTLDELDPPRWAPPAADATRLVREVHRLRRIPLGELGPADLRTLLSQQVALPYVLPLAVRLL |
| A0A6H1LQ23 | 7-72 | RDRCLEELERDCWPVPPADATRLVATAHALRRRPIGELTAEDMRLLIGQDIALPYLLPLALKVLRD |
| A0A6G2WK45 | 23-97 | None |
| A0A327ZBM4 | 4-76 | None |
| A0A849FAL5 | 4-63 | None |
| A0A2R4M0V5 | 19-79 | None |
| A0A3B9ALZ0 | 5-68 | None |
| A0A7H0HVP2 | 26-103 | None |
| A0A810MSB4 | 139-218 | None |
| A0A1G5JM58 | 43-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.