DPCstruct | MC645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101JCX0 | 3-91 | APDELRLLPWTAPDGKPCYLSTDSDRSRLSLLADDIEAAQLDSGEQVLHGARAVLADAKAGERAVRFALTRTVESLTDVLRIAASRG… |
| A0A3L8K581 | 255-357 | TTRAGAPMRLLPWESESGNPAFVSTDPGGHVSQVADHVEAVQMKDAESVMRIAQAVLDDEKADKTDLRFALREATKALRGITRIAHS… |
| A0A6G3UAT7 | 1-103 | None |
| A0A7H1B7S7 | 3-84 | None |
| A0A640TK08 | 54-147 | None |
| M2ZZ41 | 23-116 | None |
| A0A170Y0U1 | 4-93 | None |
| A0A7X0K5J4 | 1-122 | None |
| A0A397PV95 | 42-141 | None |
| A0A419VLE0 | 24-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.