DPCstruct | MC64495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 153 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF09280- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TR08 | 2-161 | VDLAASDLLSGSNPDTMINQIMDMGGGSWDRDKVQRALRAAYNNPERAINYLYTGIPVTAEVAVPVVGQGANTTDAAPGETGLSGIP… |
| A0A1Q3FY05 | 67-189 | QIKIQRITEMGYSEEEARIALEICDNNPDRAVEYLLSEIATSSMPSAVGGGAGGGGGASSGGLLAGSQESRLAFLREHPTFLEMKRL… |
| A0A7S0AVK2 | 19-179 | None |
| A0A287TR03 | 2-146 | None |
| A0A453KSR2 | 1-172 | None |
| A0A484KWT6 | 302-471 | None |
| A0A830CFP3 | 1-136 | None |
| A0A482VTB7 | 65-199 | None |
| A0A0G4HJA5 | 156-313 | None |
| A0A7M5VDG8 | 156-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.