DPCstruct | MC64487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077QDB3 | 20-94 | GVFDVINEMNRQDEKWGADRNHHPFIWNAILNEEVGEFAQAILHDEFGGEHAETAREELVQIAAVALQIIEMYDR |
| A0A829CWC6 | 1-81 | MKEKIIQEILREREKQDQEWGEQNHIPIEWCAILGEEVGEVNKAALETHFKYDGKNDLSDYRKELIQVAAVALAMIECLDR |
| A0A4R5GE59 | 83-165 | None |
| A0A0F9G0I4 | 1-74 | None |
| A0A1S6RWG8 | 5-84 | None |
| A0A5C7MBR4 | 3-84 | None |
| A0A0J2GZ48 | 1-82 | None |
| A0A0F9JFC7 | 1-103 | None |
| A0A6M3XR11 | 6-88 | None |
| A0A2G0QG75 | 19-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.