DPCstruct | MC64483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6I9I7 | 124-310 | KLVTVLRLSVPYTGLIVTARESAEMRREVIGVGCTQTDASTRIDIGGYTSALQALAKKEKADQQIDEQQFTLGDTRSLDEVVRELAE… |
| A0A354F4U1 | 1-173 | MKLTAILRLAVPYTGIILSTREQSGLRDRLFHLGVSQISANSRTYPGGYTKNGDLSGNEGQFSVGDCRTTQEVIRDISKDGFSPSFC… |
| A0A1E7I186 | 199-371 | None |
| A0A7V2EV97 | 168-337 | None |
| A0A7V3KPG2 | 224-398 | None |
| A0A1J4JQV0 | 47-219 | None |
| A0A7S3JMV3 | 365-566 | None |
| A0A7C1YH08 | 1-150 | None |
| A0A1V5JS85 | 69-219 | None |
| A0A3M1X6G4 | 91-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.