DPCstruct | MC6448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A346QXI3 | 1-92 | MTTDSLRAIRTPVSIAAVGRDTEAPSDLCAEWVHGILPNSTFALLDPEAGHYVFFCTCSVWGQSHMPDICRDAPGVDRRVIHDGAAA… |
| A0A6N4TZE5 | 3-109 | VLADPLDAFPTAATVQDISAPIQLWASEYGGDGVLPETTPALSKLLPKKPEYHLVSGAAHFVFLAPCAPKQAVSVPRICVDAGGFDR… |
| A0A2E7WKW2 | 61-164 | None |
| A0A257JKH7 | 188-278 | None |
| U2CXF2 | 455-560 | None |
| A0A536VPV1 | 31-143 | None |
| A0A3M3F204 | 2-94 | None |
| A0A858WSN2 | 41-156 | None |
| A0A5C4LIY4 | 1-87 | None |
| A0A2K9D063 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.