DPCstruct | MC64476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0SJU5 | 10-111 | PSLSCCSQLTTFSFCGNPMSMAVLESLLHHTMGLSELSHVLYPAALESYEDVCSILHLGLLAQQHAGVKHLLCESGQLSMVWFSTNP… |
| A0A5E4D8R3 | 91-182 | ITDSQLQALLPALSRCSQLRVLSFHGNRIFMSALRDLLLHTARLSQLSIELYPAPLESYDAQGAIHPGRCSQLCAELTAIVRDFRQP… |
| A0A452DQU0 | 170-262 | None |
| S7PC19 | 76-174 | None |
| S7PDH5 | 181-260 | None |
| S7QAQ9 | 1-94 | None |
| F9W358 | 54-164 | None |
| A0A6P3FPP2 | 269-363 | None |
| F9WFY0 | 57-148 | None |
| A0A6B0SCL1 | 330-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.