DPCstruct | MC6447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A7KF31 | 68-124 | IDAGVTFAQKFNLRPGITLSPSQVAKLTTDIVWFENQSVRLPNGKVETVLVPKVYAM |
| A0A844ULX9 | 96-147 | DNAARQQKGLGLEFGVALTAEQIAQLDGSILWWESVTINEQTVMVPKLYLSP |
| F7L433 | 1-58 | None |
| A0A0E2V473 | 1-51 | None |
| A0A447KPF8 | 112-172 | None |
| A0A1M5YSW4 | 227-281 | None |
| A0A7W5ZAL0 | 9-68 | None |
| A0A0M0ECW3 | 186-235 | None |
| A0A0P9I9Y6 | 306-364 | None |
| A0A0S4UE71 | 12-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.