DPCstruct | MC64466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 76.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8IVM5 | 206-274 | MQDNAPLMTALAKLIAVNMPDLVLFVGEALVGNEAVDQLVKFNQALADHSDKPRLIDGIVLTKFDTIDD |
| A0A654H6T9 | 548-618 | MQDNEPLMRALAKLITVNQPDLVLFVGEALVGNEAVDQLVKFNRSLANFSNTEKPHTIDGIVLTKFDTIDD |
| A0A261XWZ5 | 513-583 | None |
| A0A7J8Y3Y6 | 1-72 | None |
| A0A433PCP6 | 1-84 | None |
| A0A815G6C1 | 538-609 | None |
| A0A814IPS0 | 871-942 | None |
| A0A7R9JPS2 | 409-479 | None |
| A0A0A9RN82 | 1-83 | None |
| A0A372RSX8 | 931-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.