DPCstruct | MC64447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4104 |
|---|---|
| Mean domain length (aa) | 221 ± 45 aa |
| Standard deviation of domain lengths | 45.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 12.55 |
| Pfam Score | 91.37 |
| Assigned Pfam label(s) | CL0221- CL0110- CL0015- CL0316- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A557S4V2 | 12-221 | ISPVTLVFMGDSITEGQYVHHSLRWTEMVAKQVRLDVSRRIDSDSLHFFNRGISGETTRQGLERFPRDVQVLQPDIITIQFGLNDCN… |
| A0A4R6G302 | 43-229 | KKIIESQIYPDVVFIGNSITEGWVASQPEFFKNNNYEGRGIGGQTTPQMLIRFIPDVVNLQPKAVVILAGTNDIAGNTGFSSVEMIT… |
| A0A2A7R253 | 2-197 | None |
| K8FD72 | 122-400 | None |
| K8FAU0 | 286-544 | None |
| A0A6L3EU24 | 92-388 | None |
| K8EA43 | 5-225 | None |
| A0A6J1ECZ4 | 681-982 | None |
| A0A5B7E0I3 | 1-140 | None |
| A0A6L3F537 | 258-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.