DPCstruct | MC6444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6BQS9 | 47-121 | DRAEKIRENRLRRMAARQGLRLVKSRRRDPRAFDYGRYMLLDEQTNGVVAGTEVIGQPSWDLDDVEERLNAPRGA |
| A0A7V9BTF0 | 1-69 | MDNAEKVRENRLRRMAKRQRLTLVKARRRDPRAWDFGTYGLIPQHGAAVTSTERRKALHLDEIEAILTG |
| A0A6N6SE21 | 1-69 | None |
| A0A1X1YP96 | 629-698 | None |
| A0A238WNM4 | 1-67 | None |
| A0A0U0ZJD0 | 3-82 | None |
| A0A0Q5VYM7 | 10-78 | None |
| A0A2W1YIW4 | 3-73 | None |
| A0A2A4FRB4 | 2-68 | None |
| A0A013WKL8 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.