DPCstruct | MC6443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9BCP2 | 5-85 | DHSQQVNDWLQAGASSSEDVLDLLCECNEPSCTATVSTTRERYLLARDEAGQLLVAAGHEHASQRVVHAWGEVLVVAPTLA |
| A0A7W0NJ27 | 17-99 | NERLLRRANELIDAGREDEPRGREELFLCECSNLSCSTNVELTCAEYAEVREFGNRYVLAPGHETASVDRVVERCEGYLIVAK |
| A0A7W1N3N7 | 103-193 | None |
| A0A7V9DI57 | 23-106 | None |
| A0A538M9V5 | 11-96 | None |
| A0A538LRP1 | 4-109 | None |
| A0A7V9MAS4 | 3-88 | None |
| A0A538MMN3 | 1-85 | None |
| A0A7V9KYP1 | 6-78 | None |
| A0A7W1Q9Q7 | 10-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.