DPCstruct | MC64427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1436 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 24.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 11.45 |
| Pfam Score | 68.30 |
| Assigned Pfam label(s) | CL0023- CL0111- PF10539- CL0072- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7WGJ2 | 2-130 | NYWLIKSEPSAYSIDDLKRDGTTSWEGVRNYQARNFMRDMRVGDKVLFYASSADPTGVSGLAEVSREARPEKDPAWSMVDIRFVKEF… |
| A0A0M1JQ67 | 5-138 | QDNILLLSIKPEYVVKLFDGTKKVELRKIKPKLMPGNRVVVYACSPVKAIVGVFEVEKVIEDSPSSLWYQVENLAGISKEAFDDYYY… |
| A0A803Q209 | 126-224 | None |
| A0A0F2NMU9 | 160-271 | None |
| A0A7S2BQQ8 | 1-115 | None |
| A0A2X4N974 | 184-288 | None |
| A0A1Z3HVJ4 | 1-154 | None |
| A0A3D1RA23 | 15-170 | None |
| A0A1F6VHX0 | 2-125 | None |
| A0A1G2RWG9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.