DPCstruct | MC64425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 405 ± 80 aa |
| Standard deviation of domain lengths | 80.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 92.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367AMT4 | 11-396 | GVVLVEAENRGLALFLRALQPAQAGPADLGDGALATGGLSYARVQWQTGIAAGVPEDAQGVGEVIVRDFGRLLEGSADRPDGAADVP… |
| A0A349N6C9 | 2-221 | FDGFIVHGGGGIIRDDQPVKIFKLMAETDMLRRAATPQPNTDNFRQWEVAGSSHVDVPFEIEYGKVRNQQEGLSIEGVTPRDSGCDL… |
| A0A4U3CFW7 | 72-480 | None |
| A0A829YC61 | 191-665 | None |
| A0A534VYG9 | 695-1149 | None |
| A0A4V3WTD9 | 31-358 | None |
| A0A4Q7U082 | 38-472 | None |
| A0A0Q4CP58 | 186-655 | None |
| A0A819XTL7 | 370-859 | None |
| A0A6I4MDM5 | 528-996 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.