DPCstruct | MC64421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 187 ± 25 aa |
| Standard deviation of domain lengths | 24.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I0DXQ4 | 16-192 | STVNLALGASTVTTKRCSVIEKRLSFYFDFNFYTLFDLSYTPFVHYNLLSNGDISFLLDGSFKGWASVNCLGKLNLSTLNIIEYTRI… |
| A0A7J5EZ49 | 9-209 | TLSSEEQAQLETAVRAEAASFIDRLAGNLKIERIDQPWFRRHRVLEVGSPMPFPARRVFVAAYDGGMHVLSAHLENLRKVAAHDPPG… |
| A0A6G6FDS1 | 479-651 | None |
| A0A429GP14 | 30-246 | None |
| A0A7X1PCP6 | 39-207 | None |
| A0A2E2MYC6 | 25-281 | None |
| H8I974 | 42-233 | None |
| A0A2A4TFS6 | 500-692 | None |
| A0A3L8C0V6 | 25-208 | None |
| A0A2E4QT90 | 39-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.