DPCstruct | MC6442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF12571- PF03406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9GLA3 | 60-158 | KAETQTQLYQAIVKIIEDNRNSAGIAEKGEVQLTNDYSGDSEVLGLTQKAGKALKALIDSLTRNLSNYIPNSKKSNVVNSSSSDTIA… |
| A0A1Q9KWU6 | 14-116 | KAVKAAYDLANGKYTAQDATTTQKGIVQLSSDTNSTSETLAATPKAVKAAYDLAAGKAPSSHTHPWNQITGVPTASLTAKGITQLSS… |
| A0A2E5G1V0 | 96-195 | None |
| A0A827UJ28 | 442-527 | None |
| A0A827W9J0 | 89-178 | None |
| A0A8B2SKL8 | 95-196 | None |
| A0A0B1MC05 | 3-85 | None |
| A0A411H7B9 | 468-552 | None |
| Q8ZNI3 | 4-88 | None |
| A0A381GPP5 | 184-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.