DPCstruct | MC64416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174V1M6 | 28-110 | GNALVKGTRDIYWISCIGSRDGTTTFFRNANNGISVSCGCFYGTIDEFAAAVTKTHGDNEHAQAYRHAIEIAKLRIKLTDAES |
| A0A6I4Q7A8 | 400-513 | TKLPDNLSVAGDLSLHETQITEIPNDLSVGGKLDLDVKSIKNIVYRESVGAHKVTLFSVFVNNEIQISIPEWDFLGNFDLFETRIDK… |
| W2C8K1 | 152-217 | None |
| A0A6I4Q3C0 | 1-103 | None |
| A0A2L0T8Q1 | 177-264 | None |
| A0A7U9ICA4 | 2-90 | None |
| A0A0G1G703 | 47-114 | None |
| A0A3N8CJC9 | 125-202 | None |
| A0A3A6KEW5 | 3-73 | None |
| A0A084Z4U6 | 80-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.