DPCstruct | MC64413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 176 ± 36 aa |
| Standard deviation of domain lengths | 35.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.38 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0023- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174SX57 | 6-158 | YNPEEILGTVESVDTSTAIIKVENDDKLRGLQVNHLVAIQSSKVDQHLIGLVSKIIRKSGYSDPIAEVTPEFAFNVIKVVLIGTHLD… |
| A0A0S8KE35 | 1-166 | MRIGEIVETMSTGFVAESFELNRPPPLGSLVVVRLPAEAGETSSGMDLYAVVTYGQTVGLDPSRRAVRRSTDTVFDQAIYQEHPELN… |
| A0A833E815 | 16-152 | None |
| A0A7W5S4P5 | 21-210 | None |
| A0A0P7HEC7 | 44-259 | None |
| A0A5N9AJV4 | 1-146 | None |
| O66421 | 36-243 | None |
| A0A7V9TUP8 | 121-263 | None |
| A0A535Y7S9 | 379-533 | None |
| A0A2C6M7F0 | 12-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.