DPCstruct | MC64411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 182 ± 43 aa |
| Standard deviation of domain lengths | 43.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8Y5C3 | 25-211 | VLSRIDDALFDVFELTDGERDLVRDFFAYTLPLNQLRANSSALGPVGPAKLEVGLYEDLDRLGEHPLATYLRVFLGKWSAVLPQGGE… |
| A0A7Z6S4Y9 | 12-165 | LTDVDKKVIFDVNHYTQEFHRRGENSMVLNPVKNNSVIKSYGVEFSRILNHTYADNGKIFKLSDIVRFNDDKFIGAVFTYDDVHVKE… |
| A0A1G3LIF0 | 729-936 | None |
| A0A2D0H9K8 | 3-141 | None |
| A0A1I5J0L3 | 12-137 | None |
| A0A7I0RS46 | 31-213 | None |
| A0A0X3TF45 | 135-358 | None |
| A0A2M7H6C2 | 42-246 | None |
| J9R7J0 | 63-280 | None |
| K2B8X6 | 179-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.