DPCstruct | MC6441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 136 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3I6H7 | 71-199 | FNNIYLASGNGKVILNKDNSLGNDQYAGIFFTKRGGTLDLNGHNQTFTRIAATDDGTTITNSDTTKEAVLAINNEDSYIYHGNINGN… |
| A0A1M2E7H9 | 1-143 | MNQQADSKGQVQAFSSVNTTSGRPTVVLTDDRQVNSDTISWGYRGGTLDVNGNSLTFHQLKAADYGAVLINNNEATRAVVTLDFDTD… |
| A0A376D1N3 | 114-249 | None |
| A0A656BN70 | 441-569 | None |
| A0A376KIR9 | 111-250 | None |
| U3U5G5 | 381-511 | None |
| A0A200L1P0 | 204-328 | None |
| A0A376NYM2 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.