DPCstruct | MC64408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 277 ± 43 aa |
| Standard deviation of domain lengths | 43.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8XW59 | 10-272 | SLRLPDQIETLLLRRPPATLNVHAPNGGHRLDLRLFPYGPDVVIPDGLRRASKLWLWVGGEVSMTVLAAMTDLEDLTITFDGAPGAL… |
| A0A1H3UK23 | 71-353 | EWHDAVGEVDLRSTGLDTVRLYGSAFDSLRLPASIRTLLLRRPSASLRVEAADLGEWLDLRLFPYGGALSVPTGLTRVPTLWLWVGA… |
| A0A645G625 | 1-217 | None |
| Q846T2 | 45-344 | None |
| A0A357N235 | 103-414 | None |
| A0A1V5UTB9 | 138-432 | None |
| A0A318WAC2 | 2-191 | None |
| A0A369UHU4 | 61-336 | None |
| A0A497UL64 | 52-356 | None |
| L1NWP8 | 125-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.