DPCstruct | MC644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2L221 | 2-63 | ILEAIQRRTEVSRMIGKARMASGGTRLVHSREMKVIERYSVLGEEGKNLAMLLLRLGRGRLG |
| A0A3L8J9E6 | 14-95 | DEAAGVITDARKRIDDLDSHIIGLVQERMAVSAVIQRERIASGGRRVNLAREMEILTHYSGQLGKPGTTLAMTLLELCRGRV |
| K0K0Y9 | 5-94 | None |
| X8B1X2 | 2-72 | None |
| A0A7X0KC82 | 12-116 | None |
| A0A327ZHU0 | 53-152 | None |
| A0A1V0VBY8 | 150-243 | None |
| A0A1V3XQM9 | 2-84 | None |
| A0A7U4BT08 | 117-215 | None |
| A0A6N7GNQ5 | 13-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.