DPCstruct | MC64397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 200 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6A0F9 | 5-216 | ELEYLLEPIAEQFGFYTKRMFGGLAVYLDDKMVLVLMEDKQTKEYRGVSYPYAIWNGLMVPTERSEHESLMADYSSLIPHVVLGKWL… |
| A0A090SCG2 | 1-167 | MFGGFGIFSDGNIFALISKGKVFLRIPETNVAETPIEQRFSYEKQGQIVTTRYQSFEPDSDEQLVKDCRTALDQAMQEKEQQQIDDV… |
| S0FAE4 | 3-191 | None |
| A0A812H375 | 43-236 | None |
| A0A161PP06 | 3-244 | None |
| S5J9S8 | 1-175 | None |
| X1WPX2 | 1-196 | None |
| A0A2D0J4I3 | 80-270 | None |
| A0A7Y4WI61 | 1-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.