DPCstruct | MC64396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 682 |
|---|---|
| Mean domain length (aa) | 192 ± 42 aa |
| Standard deviation of domain lengths | 41.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.91 |
| Pfam Score | 99.42 |
| Assigned Pfam label(s) | CL0063- CL0649- CL0377- CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5J5L3 | 23-192 | SPIQKFDDRVMIDLMEHRTPEKTGFFRFMTNTCNYGNLGIPAGLFIGGVLGHDQAMRQNSLYVASSTLISFGFTTLIKQIVKRPRPF… |
| A0A518VK93 | 121-337 | IALLESFSHLSTDVLQQNMAIVTRINREATTGQREQALVDAEGQGYLYYLADALGPRLGNIFLNAYDHGEIRKAAALLKLSAVSTSA… |
| A0A538QP63 | 2-164 | None |
| A0A538QL75 | 159-344 | None |
| A0A1I6DY83 | 26-204 | None |
| D1W4S3 | 15-169 | None |
| K7FJK3 | 5-218 | None |
| A0A538QSQ2 | 4-156 | None |
| A0A6G1J0C3 | 50-281 | None |
| A0A3B9FYD3 | 60-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.