DPCstruct | MC64390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.29 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0023- PF14510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6P5T6 | 95-183 | ATNDQDNYALLSAVKERLNRAGIEVPKIEVRYTNLNVSADVLIGSRALPTLFNYTRDALEGILTNLRLFRSKRHSLTILDNVSGVIK… |
| A0A2H5N4K9 | 126-212 | EEDNEKYLKKFRHRIDKVGIRLPKVEVRFDHLTIEANCYIGTRALPTLPNAARNIAESILGLLGIEMAKRTKLTILKDVSGIIKPSR |
| A0A1D6FKD7 | 36-123 | None |
| A0A2Z6M3L3 | 3-102 | None |
| A0A6A4N9C4 | 52-137 | None |
| A0A484N6Z2 | 112-197 | None |
| J3MUY2 | 12-97 | None |
| A0A2Z6MVI0 | 1-66 | None |
| A0A287WL66 | 1-85 | None |
| A0A2G2X7C9 | 302-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.