DPCstruct | MC6439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 152 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6QKJ0 | 7-134 | SDPTVASSARWFWWIAGLSLVNLFLFYSGSNTNFVIGLGMTAVVSAAFSDPKVVGLILSALIIGHYGVIGYFALRDKLWAFYIGLAV… |
| A0A1V5MAW6 | 4-152 | RFEAAFKSSASWFFWMAGCTVVNLFMVFTKSNFGLALGMSDSLMMAFVNLLKPPSTETGALIAFGGVIASNVLYIALMAVFGIFAGK… |
| A0A2S4ZXE9 | 35-187 | None |
| A0A847Z2J5 | 1-154 | None |
| A0A5B3FRA5 | 52-215 | None |
| R4KBH0 | 132-283 | None |
| G8LU13 | 155-315 | None |
| A0A2N2P0T4 | 3-166 | None |
| A0A1P8FGL8 | 304-445 | None |
| A0A316QMG6 | 4-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.