DPCstruct | MC6438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 27.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6NY16 | 7-181 | APPFIGFVAGVISKNPSTAQSLAEQLVSLPEVDQPVLILGIWYSTYPEAKPLLKRLAQSMSKHKKMIDHLLANDRPSLLELPLEKGS… |
| A0A1V5MA87 | 264-475 | DTDWQLWQTYYYLFPANPDLIVASLKRAEDSGSLDSIGSIPPIAAFTSRIFAQNPKKISYWVEALGSLSATHKNQVLSSALVWSGVP… |
| A0A353X500 | 6-239 | None |
| A0A1C7PB04 | 124-334 | None |
| W6K580 | 28-259 | None |
| A0A3D2SUF1 | 62-280 | None |
| A0A2H6IZW3 | 27-265 | None |
| A0A290Q2Y3 | 1-216 | None |
| A0A447CSX4 | 23-310 | None |
| A0A1B6VY56 | 2-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.