DPCstruct | MC64374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 194 ± 27 aa |
| Standard deviation of domain lengths | 27.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08900 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9QKR3 | 12-213 | YQYSTARLKGHLVLNTEQAKAFSGNRFDNVMTALFVIDVVARKLAQKLKSFDYQAVASAVSTKLADTEKAISDDTARISALLGALAQ… |
| A0A388RK11 | 1-125 | MSYCTDFVRNFLRSDYNFITSKFSVASKGKILALDEAFRAAQEWMDARLQWIERQPRRHLSLRFDQRQLVVTHSLAGRLIRLLNQHD… |
| A0A378JXP1 | 3-207 | None |
| A0A2A7TXV3 | 9-206 | None |
| A0A848IIH3 | 118-309 | None |
| A0A4R6Y0U4 | 108-313 | None |
| A0A822WC27 | 1-161 | None |
| W1I114 | 1-174 | None |
| A0A420RY51 | 100-293 | None |
| A0A5A9EY22 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.