DPCstruct | MC64362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0039- PF03441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4C697 | 7-97 | MYWGKKLLEWTRSPEEGFHAALVLNNKYALDAPDTNSYAGVAWVFGKHDQGWRERPIFGKVRYMNEVGLKRKFRMDAYVLKVGRLAA… |
| A0A493T8K2 | 291-379 | MHGFLRMYWAKKILEWTRSPEEALQFAIYLNDRYELDGRDPNGYVGCLWSICGIHDQGWKERDVFGKIRYMNYSGCKRKFDVDQFER… |
| R1C826 | 11-85 | None |
| A0A7S3FQ21 | 174-285 | None |
| A0A183T1L8 | 231-365 | None |
| A0A0R3TRG7 | 120-209 | None |
| A0A510HMT1 | 75-148 | None |
| A0A388KW63 | 778-877 | None |
| A0A7S0AGJ8 | 79-185 | None |
| A0A2Y9S911 | 263-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.